SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861066|ref|YP_006363306.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861066|ref|YP_006363306.1|
Domain Number 1 Region: 186-424
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.97e-72
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 9-188
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 4.48e-62
Family Aminoacid dehydrogenases 0.00000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389861066|ref|YP_006363306.1|
Sequence length 425
Comment Glu/Leu/Phe/Val dehydrogenase [Thermogladius cellulolyticus 1633]
Sequence
MSLATLYENDPVYQQAVQQLKQSASILGLPEEIVEVLRHPEKLVQVRITVKRDNGKVESF
IGWRSQHNSALGPYKGGIRYSENATAGETVALSMWMTWKNALAGIPYGGGKGAVRVNPKT
LSARELEELSRKFFAAIAKEVGPDVDIPAPDVYTNPQTMAWYYDEYSKLVGYNAWGVVTA
KPAELGGLAVRLVSTGYGVALGVREAAKKWLGGLEGKTVAVHGFGNVGGHAARYLSQWGA
TVVAVSDTSGVVYDPKGLKVKEVMEVKEKTGRVIDYKSGDVKVFTNDKAIFELPVDIIVP
AAIENVITRENAPNIKAKLVVEGANGPTTPEADEILHKKDVIVVPDVLANAGGVVMSWIE
WSHNRMGCWLTDDEALARLDKMMTQNFNKVFDEWEKKYRQYPMRTAAYAIAVDRVVKAMK
LRGWI
Download sequence
Identical sequences I3TEI0
gi|389861066|ref|YP_006363306.1| WP_014737418.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]