SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861162|ref|YP_006363402.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861162|ref|YP_006363402.1|
Domain Number 1 Region: 49-138
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000122
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389861162|ref|YP_006363402.1|
Sequence length 139
Comment hypothetical protein TCELL_0840 [Thermogladius cellulolyticus 1633]
Sequence
MEDWLVYALLDAFMAALATILAKVGLSGVDSITATAVRSVVMMLFTVGFMLVVQGPGLLR
TLTSRDVVFIVLSGVAGALSWLLYFMALQKGPTTPVVVVDKSSLLFVVAMSVILLRESLT
LKKAVAAALMFAAIILLSM
Download sequence
Identical sequences I3TES6
WP_014737514.1.39459 gi|389861162|ref|YP_006363402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]