SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861168|ref|YP_006363408.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861168|ref|YP_006363408.1|
Domain Number 1 Region: 140-232
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000418
Family Multidrug resistance efflux transporter EmrE 0.021
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000824
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861168|ref|YP_006363408.1|
Sequence length 233
Comment hypothetical protein TCELL_0846 [Thermogladius cellulolyticus 1633]
Sequence
MLSRRKFVRPSGFRALVVSALSGVFLGLHFALWMESLFLVPVFESTLLVDTYPLLLLVME
RLALGGQVRAREVAGLLSGGVFLYLFLGGPGLKLSEGDVYAMISSLFVASYFLLGRVARS
RFGLGTVEYVIPTYATASLTALLYSLVRGSFQVPDTPHKILFALLLALVPMIGGHTLMNY
LLGFFKSNIVTSIVFTEPIGASVLAYLVLGQVLEPYKVLLGLGVIASIVLVWV
Download sequence
Identical sequences I3TET2
gi|389861168|ref|YP_006363408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]