SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861242|ref|YP_006363482.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389861242|ref|YP_006363482.1|
Domain Number - Region: 145-183
Classification Level Classification E-value
Superfamily E set domains 0.0084
Family Arrestin/Vps26-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389861242|ref|YP_006363482.1|
Sequence length 404
Comment ABC transporter [Thermogladius cellulolyticus 1633]
Sequence
MIRLSDIIMLSYKGLTEKRARALLTIIGVAIGPLAITMIYGVTSSYSDYIVNQIQGLGQN
LVIVTPSQGYKLSERDLDRIKGLDHVVTAAPFYTTQGYLGGRPTDTVFVYAVDPDFLLKA
ITSLEVLEGTPPTQADVGKGMIGYDIAYDDNGHRVYSPGDVVSVTVYVSNSNGVSARRLN
IMVSAVLAKYGGALFLNPDKSIFVPFNSARLLMGASDWSGILVLVDSPTNVDGVARKISD
LLGNNANVISFVGIARIASSITSAVNFMTFAASLSAFAVAVAGIASTMITSVMERTREIG
VMKAIGFTDTQVVVLTLFEGVLMSLIGGAIGIAGGVVGAFQLASRGLTISSGEFFKVTIR
TAPKFTPGLIGGVIGLTILVGVLGSILPAYRAAKIPPAEALRYE
Download sequence
Identical sequences I3TF06
WP_014737594.1.39459 gi|389861242|ref|YP_006363482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]