SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861319|ref|YP_006363559.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861319|ref|YP_006363559.1|
Domain Number 1 Region: 174-521
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.11e-112
Family Nqo4-like 0.0000221
Further Details:      
 
Domain Number 2 Region: 18-179
Classification Level Classification E-value
Superfamily Nqo5-like 1.12e-32
Family Nqo5-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861319|ref|YP_006363559.1|
Sequence length 540
Comment membrane-bound hydrogenase, subunit NuoCD [Thermogladius cellulolyticus 1633]
Sequence
MPGVEEYVRLAQERGGRWVVHGDTVHLVVDPSDLRPIADKIFNEYGACFRTCVGTDERPL
NNHFSITHLFTDDRSGLYIALKSYLDPENPVAPSIADVVPAADWCELEAWDMLGIRFEGR
RLERLVLPYWWPEGVHPLRKEFDYKSRPDVSLARSERVTLRKEVGTVPLGPYHPALHEPE
YFELYVKGERVVDVRYRGFHVHRGIEKLAESRMNYQQVNFLAERICGICGFEHSTCYALA
VEKAAGVDVPERAQFIRSIVLEVERLHSHLLLLGVAFHLLGYDAGFMHMWRVRERTMVLA
EMLTGSRKTYGINLVGGVRRDINEEKKSKVLSELGELVKDFKRVVEIAVSAPNVKRRLTG
TGLLPKEDARRLGVEGPVARGSGIDKDARRDLPYAAYKYASFRVPVYTEGDNMARVLVRV
EEVFESVSIIEQLLDKLPKGPIMAEKVEIPPGRVGVQVVEAPRGGDVHYVLTGDGRPYRW
RVRAPTYANIPALKVMLRDQRLADAPITIASIDPCFSCTDRVVVVRDDGVVERLEVGASW
Download sequence
Identical sequences I3TF83
WP_014737671.1.39459 gi|389861319|ref|YP_006363559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]