SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861348|ref|YP_006363588.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861348|ref|YP_006363588.1|
Domain Number 1 Region: 50-196
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.71e-29
Family Nuclease 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389861348|ref|YP_006363588.1|
Sequence length 199
Comment phospholipase D/Transphosphatidylase [Thermogladius cellulolyticus 1633]
Sequence
MGVSVLRGVGLGALVAVFIAGLVVGYYVALHVAGPGGQQPAAPEGGVFFLPDRAYYGNLT
YYLDRANKSVYVVMYVVKYDPRYPDDPVNKLLRKLVDLYKKGIDVRVVVDDQTLISYPDT
INYLVQNGVPVKLDESKSVTTHAKIVIIDGKYVFIGSHNWTESALTRNHETTLLVDSTKL
AQEVTSYFESVWSSGRPPA
Download sequence
Identical sequences I3TFB2
WP_014737700.1.39459 gi|389861348|ref|YP_006363588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]