SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861451|ref|YP_006363691.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861451|ref|YP_006363691.1|
Domain Number 1 Region: 183-445
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-83
Family RecA protein-like (ATPase-domain) 0.0000789
Further Details:      
 
Domain Number 2 Region: 457-546
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 8.63e-22
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0025
Further Details:      
 
Domain Number 3 Region: 4-73
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000000000034
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|389861451|ref|YP_006363691.1|
Domain Number - Region: 121-187
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0989
Family Biotinyl/lipoyl-carrier proteins and domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389861451|ref|YP_006363691.1|
Sequence length 591
Comment V-type ATP synthase subunit A [Thermogladius cellulolyticus 1633]
Sequence
MPSRTGRIHRIAGPLVVATGIPSPMMYEVVYVGEEGLIGEVISVRGERAYIQVYEETTGL
TVGERVEATGELLSAELGPGLIGTIYDGLQRPEVEIAKAVNDIFIKRGVRVNSLNRSTKW
VFAADQRVRVGDKVEPGDTIGLVQETPIVTHKIMIPPGVSGTLTWRAGDGEYSVEDVVAV
VESGDKKHEVKLYHRWPVRIPRPYKEKLPPSEPLTTGIRVIDLMFPIAKGGKAAVPGGFG
TGKTVLLQSLAKWSYADIAIFVGCGERGNEMADALKSFLELHDVRRNRPMMERSIFIANT
SNMPVAARETSVLLGVTLAEYFRDMGYDVLLVADSTSRWAEAMREISGRMEEMPGEEGFP
AYLASRLAEFYERAGRVVALGRPERTGSVTIFGAVSPPGGDFSEPVVRNTLRYVQALYAL
DYDLATRRHFPAINWLMSYSLYVDYVKEYLDERSAGRWHETRNMFVKILQREAELLDIVR
LVGPEALPEEDKLTLEVARMIREGFLQQYAYDPNDAFSPLEKGFLIMEAIRRFHEVALSL
IKSNVPLFKIRELKSPYMVYKLKLYAPHEVEKVYNDYVQTLEVEVKKLTGG
Download sequence
Identical sequences I3TFL5
WP_014737803.1.39459 gi|389861451|ref|YP_006363691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]