SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197119697|ref|YP_002140124.1| from Geobacter bemidjiensis Bem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197119697|ref|YP_002140124.1|
Domain Number 1 Region: 28-277,406-465
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.65e-45
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00081
Further Details:      
 
Domain Number 2 Region: 493-636
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 6.02e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 261-402
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.55e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197119697|ref|YP_002140124.1|
Sequence length 637
Comment succinate dehydrogenase flavoprotein subunit [Geobacter bemidjiensis Bem]
Sequence
MILDGKCPKGPIQTSWDRHRFDLKLVNPANKRKYKILVVGTGLAGGAAAASLGELGYNVE
AFCYQDSARRAHSIAAQGGINAAKNYPNDGDSIYRLFYDTIKGGDFRAREADVWRLAQVS
NNIIDQCVAQGVPFARDYAGYLDNRSFGGAQVSRTFYARGQTGQQLLLGAYSALSRQVKA
GTVKLFARTEMLDLVVVDGEAKGITIRDLITGEIRTHVGDAVVLATGGYVNVFYLSTNAM
GCSVTANWRAHKKGAFFANPCYTQIHPTCIPQSGDHQSKLTLMSESLRNDGRCWAPKKKG
DNRHPNEIPEDERDYYLERKYPSFGNLAPRDIASRAAKEQCDDGRGVGPGGRGVNLDFSA
AIQRVGEDTIRERYGNLFEMYEKITDENAYKQPMRMYPAPHYSMGGLWVDYNCESNVPGL
FVLGEANFSVHGANRLGASALMQGLADGYFVIPYTIANYLAKTKPGAVKADHPECKKSIE
DVKSYNNRLLNINGKKTVSEFHRELGKIMWENVGMARSEETLKDAIKKIPVLREEFWKNV
KVTGKGEELNQQLENAGRVADFLEFGELMAKDALHRNESCGGHFRVEHQMPDGEAKRDDE
NYCYVGAWEFKGVDKEPELHKEPLAFDNVHLAVRSYK
Download sequence
Identical sequences B5EAI9
404380.Gbem_3333 WP_012531761.1.31571 gi|197119697|ref|YP_002140124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]