SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197120029|ref|YP_002140456.1| from Geobacter bemidjiensis Bem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197120029|ref|YP_002140456.1|
Domain Number 1 Region: 5-70
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.000000000000262
Family TTHA1013-like 0.056
Further Details:      
 
Domain Number 2 Region: 70-111
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000003
Family SeqA N-terminal domain-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197120029|ref|YP_002140456.1|
Sequence length 113
Comment HicB family protein [Geobacter bemidjiensis Bem]
Sequence
MKKTDKYLKLVEWSEEDGCYVGTCPGLIYGGVHGDNEAEVYRELCETVAEAIELYEADGK
PLPPATANKEYSGRFVLRVDKELHRQVAIRALRSGESLNSYCQKILKKAIAEG
Download sequence
Identical sequences B5EDN2
WP_012532097.1.31571 WP_012532097.1.49185 404380.Gbem_3668 gi|197120029|ref|YP_002140456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]