SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197117386|ref|YP_002137813.1| from Geobacter bemidjiensis Bem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197117386|ref|YP_002137813.1|
Domain Number 1 Region: 139-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.68e-133
Family Enolase 0.00000000641
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.14e-58
Family Enolase N-terminal domain-like 0.00000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197117386|ref|YP_002137813.1|
Sequence length 429
Comment phosphopyruvate hydratase [Geobacter bemidjiensis Bem]
Sequence
MSQITDVYAREILDSRGNPTLEVEVFLDSGVMGRAAVPSGASTGEREALELRDGDKGRYL
GKGVEQAVSNVNDIIADEITGMDATDQVGIDKKMLELDGTEFKSRLGANAILGVSLAVAK
AAAEEVGVPLYQYIGGCNAKELPLPMMNIINGGAHADNNVDIQEFMIMPAGAANFKEALR
MGAEIFHALKSVLKGKGYNTAVGDEGGFAPNLKSNEEALEVIMEAIVKAGYKPGEEVLLA
LDVASSELFENGVYTLENEAESKKTADQLVDFYENLVNKYPIVSIEDGMAENDWDGWKKL
TDRLGKRIQIVGDDLFVTNPSILKEGIKKGIANSILIKLNQIGTLTETLDAIEMAKRAGY
TCVISHRSGETEDTTLADLAVAVNAGQIKTGSLCRTDRVCKYNQLLRIEDELDDVAQFRG
HEVFYNIKK
Download sequence
Identical sequences B5EGF2 C6E471
gi|253701859|ref|YP_003023048.1| gi|197117386|ref|YP_002137813.1| WP_012529431.1.31571 WP_012529431.1.50895 404380.Gbem_0996 443144.GM21_3264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]