SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197118257|ref|YP_002138684.1| from Geobacter bemidjiensis Bem

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197118257|ref|YP_002138684.1|
Domain Number 1 Region: 2-250,351-443
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-66
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000384
Further Details:      
 
Domain Number 2 Region: 233-347
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5.23e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000938
Further Details:      
 
Domain Number 3 Region: 424-527
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.7e-30
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197118257|ref|YP_002138684.1|
Sequence length 533
Comment L-aspartate oxidase [Geobacter bemidjiensis Bem]
Sequence
MKVQSDFLVIGSGIAGLSFALQAAAHGTVALLAKRDIAETATNYAQGGIASVSSNEDSFD
AHVQDTLVAGAGICHEDVVRLVVEEGPQVIANLIEWGVKFTRNTSGEAYDLTREGGHSQR
RILHAADITGREIQRALVEAAHAHDNITIYENHAAIDLITESKVLKKKTDQNRCLGAHVL
DVKAGVVKTFSSRITLLASGGAGKVYLYTCNPDIASGDGVAMAYRAGATIANMEFMQFHP
TTLFHPNARSFLISEAVRGEGAILKRRDGTAFMERYHHLKDLAPRDIVARAIDNEMKTHG
DDCVYLDIRHRGAEYITSRFPNIYQTCLDYGIDMTKEMIPVVPAAHYLCGGVAVDKNAET
DVKHLYAIGEVAFTGLHGANRLASNSLLEAAVYAGRAFHHAVEILKGGGFPSYAIPEWDS
GTATNSDEMVVVSQNWDEIRRFMSNYVGIVRSDKRLARAMHRIELIQDEIEEYYWNFIVT
SDLIELRNIATVAQLIVTCAQMRKESRGLNYNIDYPNVDDANWKRDTFVKKQF
Download sequence
Identical sequences B5EB27
WP_012530306.1.31571 404380.Gbem_1874 gi|197118257|ref|YP_002138684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]