SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209549331|ref|YP_002281248.1| from Rhizobium leguminosarum bv. trifolii WSM2304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209549331|ref|YP_002281248.1|
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily YccV-like 2.75e-34
Family YccV-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209549331|ref|YP_002281248.1|
Sequence length 109
Comment hemimethylated DNA binding protein [Rhizobium leguminosarum bv. trifolii WSM2304]
Sequence
MKERVAKFSIGEVVRHKVFPFRGVIFDVDPEFANTEEWWNSIPAEVRPSRDQPFYHLLAE
NDESEYVAYVSEQNLMNDESGTPLRNPQIYQIFDQAPSGQFKPKMSFAH
Download sequence
Identical sequences A0A0N0LBN7 A0A154IFH9 A0A1Q8HNA9 A0A1S1PV20 A0A1W6KLZ6 A0A235AW25 A0A2A6I455 B5ZP61 C6AXR0 J0BJI7 J0GYD5 Q1MGN8 W0ICX2
WP_003539613.1.100861 WP_003539613.1.102073 WP_003539613.1.10236 WP_003539613.1.14669 WP_003539613.1.17708 WP_003539613.1.18915 WP_003539613.1.20038 WP_003539613.1.21878 WP_003539613.1.23162 WP_003539613.1.28224 WP_003539613.1.38826 WP_003539613.1.39278 WP_003539613.1.40175 WP_003539613.1.42569 WP_003539613.1.46073 WP_003539613.1.53662 WP_003539613.1.53928 WP_003539613.1.54942 WP_003539613.1.61011 WP_003539613.1.62169 WP_003539613.1.67177 WP_003539613.1.68417 WP_003539613.1.70093 WP_003539613.1.71733 WP_003539613.1.80295 WP_003539613.1.81419 WP_003539613.1.84753 WP_003539613.1.88983 WP_003539613.1.91504 WP_003539613.1.91561 WP_003539613.1.98283 WP_003539613.1.99504 gi|241204644|ref|YP_002975740.1| gi|209549331|ref|YP_002281248.1| 216596.RL2391 395491.Rleg_1919 395492.Rleg2_1735 gi|116252143|ref|YP_767981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]