SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|215485571|ref|YP_002328002.1| from Escherichia coli O127:H6 str. E2348/69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215485571|ref|YP_002328002.1|
Domain Number 1 Region: 93-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000693
Family NfeD domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|215485571|ref|YP_002328002.1|
Domain Number - Region: 31-80
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000353
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|215485571|ref|YP_002328002.1|
Sequence length 151
Comment hypothetical protein E2348C_0427 [Escherichia coli O127:H6 str. E2348/69]
Sequence
MELMVVHQHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLLPLGWEWQGVMFA
VLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGQRFVLESPLVNGRGHMRVGDSSW
PVSASEDLGAGTHVEVIAIEGITLIIRAVIA
Download sequence
Identical sequences A0A2D0NMJ3 B7UKH1 E3XH50
gi|215485571|ref|YP_002328002.1| 574521.E2348C_0427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]