SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|215488411|ref|YP_002330842.1| from Escherichia coli O127:H6 str. E2348/69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215488411|ref|YP_002330842.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.27e-109
Family FMN-linked oxidoreductases 0.0000000000109
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.53e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000328
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000696
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|215488411|ref|YP_002330842.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli O127:H6 str. E2348/69]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEGGGTFAEMVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTPKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKLGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A2D0NV34 B7UIY8 E3XTL8 H4IGK3 H4IXA9 H4JD24 H4KM65 H4LHD7
574521.E2348C_3374 WP_000121467.1.10787 WP_000121467.1.15869 WP_000121467.1.19465 WP_000121467.1.22543 WP_000121467.1.24909 WP_000121467.1.25372 WP_000121467.1.30550 WP_000121467.1.30691 WP_000121467.1.32587 WP_000121467.1.32938 WP_000121467.1.5787 WP_000121467.1.59793 WP_000121467.1.59900 WP_000121467.1.61617 WP_000121467.1.69735 WP_000121467.1.76643 WP_000121467.1.77487 WP_000121467.1.79749 WP_000121467.1.87990 WP_000121467.1.88147 WP_000121467.1.94686 WP_000121467.1.97437 gi|215488411|ref|YP_002330842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]