SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410501358|ref|YP_006935885.1| from Helicobacter pylori Rif2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410501358|ref|YP_006935885.1|
Domain Number 1 Region: 18-189,231-369
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.42e-70
Family TK-like PP module 0.098
Further Details:      
 
Domain Number 2 Region: 308-483
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.35e-43
Family TK-like Pyr module 0.012
Further Details:      
 
Domain Number 3 Region: 481-612
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.22e-21
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410501358|ref|YP_006935885.1|
Sequence length 616
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Helicobacter pylori Rif2]
Sequence
MQNKTFDLNPNDIAGLELVCQTLRNRILEVVSANGGHLSSSLGAVELIVGMHALFDCQKN
PFIFDTSHQAYAHKLLTGRFESFSTLRQFKGLSGFTKPSESAYDYFIAGHSSTSVSIGVG
VAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDRKYPMIMILNDNEMSISTPIGAL
SKALSQLMKGPFYQSFRSKVKKILSTLPESVNYLASRFEESFKLITPGVFFEELGINYIG
PINGHDLSAIIETLKLAKELKEPVLIHAQTLKGKGYKIAEGRYEKWHGVGPFDLDTGLSK
KSKSAILSPTEAYSNTLLELAKKDEKIVGVTAAMPSGTGLDKLIDAYPLRFFDVAIAEQH
ALTSSSAMAKEGFKPFVSIYSTFLQRAYDSIVHDACISSLPIKLAIDRAGIVGEDGETHQ
GLLDVSYLRSIPNMVIFAPRDNETLKNAVRFANEHDSSPCAFRYPRGSFALKEGVFEPSG
FVLGQSELLKKEGEILLIGYGNGVGRAHLVQLALKEKNIECALLDLRFLKPLDPNLSAIV
APYQKLYVFSDNYKLGGVASAILEFLSEQNILKPVKSFEIIDEFIMHGNTALVEKSLGLD
TESLTDAILKDLGQER
Download sequence
Identical sequences A0A0L0PFF9
gi|410023591|ref|YP_006892844.1| gi|410501358|ref|YP_006935885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]