SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410501398|ref|YP_006935925.1| from Helicobacter pylori Rif2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410501398|ref|YP_006935925.1|
Domain Number 1 Region: 4-220
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.05e-61
Family "Hypothetical" protein ybl036c 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410501398|ref|YP_006935925.1|
Sequence length 222
Comment hypothetical protein C730_02005 [Helicobacter pylori Rif2]
Sequence
MLDYRQKIDALITKIEKARTAYSRHHIVKIVAVSKNASPEAIQHYYNCSQRAFGENKVQD
LKTKMHSLEHLPLEWHMIGSLQENKINALLSLKPALLHSLDSLKLALKIEKRCEILGVNL
NALLQVNSAYEESKSGVVPEEALEIYSQISETCKHLKLKGLMCIGAHTDDEKEIEKSFIT
TKKLFDQIKNASVLSMGMSDDFELAIACGANLLRIGSFLFKE
Download sequence
Identical sequences A0A1Y3E2D5 A0A2J9KJX4 O25156
gi|15645023|ref|NP_207193.1| NP_207193.1.64343 WP_000888213.1.100370 WP_000888213.1.14785 WP_000888213.1.15441 WP_000888213.1.15770 WP_000888213.1.16964 WP_000888213.1.18045 WP_000888213.1.21161 WP_000888213.1.21640 WP_000888213.1.23156 WP_000888213.1.23346 WP_000888213.1.26233 WP_000888213.1.26656 WP_000888213.1.27034 WP_000888213.1.29892 WP_000888213.1.30129 WP_000888213.1.32874 WP_000888213.1.32920 WP_000888213.1.32991 WP_000888213.1.34734 WP_000888213.1.34950 WP_000888213.1.37759 WP_000888213.1.3847 WP_000888213.1.3935 WP_000888213.1.45128 WP_000888213.1.45388 WP_000888213.1.45788 WP_000888213.1.46484 WP_000888213.1.51993 WP_000888213.1.53728 WP_000888213.1.54470 WP_000888213.1.56818 WP_000888213.1.5696 WP_000888213.1.58727 WP_000888213.1.61092 WP_000888213.1.63400 WP_000888213.1.64394 WP_000888213.1.65101 WP_000888213.1.65885 WP_000888213.1.66907 WP_000888213.1.71693 WP_000888213.1.73531 WP_000888213.1.74411 WP_000888213.1.7512 WP_000888213.1.76964 WP_000888213.1.77110 WP_000888213.1.77453 WP_000888213.1.78022 WP_000888213.1.78855 WP_000888213.1.79031 WP_000888213.1.79522 WP_000888213.1.81922 WP_000888213.1.84468 WP_000888213.1.85386 WP_000888213.1.85662 WP_000888213.1.87485 WP_000888213.1.88687 WP_000888213.1.8903 WP_000888213.1.93861 WP_000888213.1.94773 WP_000888213.1.95955 WP_000888213.1.97942 WP_000888213.1.98792 WP_000888213.1.98910 WP_000888213.1.990 gi|15645023|ref|NP_207193.1| gi|410023631|ref|YP_006892884.1| 85962.HP0395 gi|410501398|ref|YP_006935925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]