SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410502082|ref|YP_006936609.1| from Helicobacter pylori Rif2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410502082|ref|YP_006936609.1|
Domain Number 1 Region: 6-313
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.65e-101
Family TK-like PP module 0.000000317
Further Details:      
 
Domain Number 2 Region: 334-512
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.07e-57
Family TK-like Pyr module 0.0000102
Further Details:      
 
Domain Number 3 Region: 516-640
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.09e-34
Family Transketolase C-terminal domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410502082|ref|YP_006936609.1|
Sequence length 641
Comment transketolase [Helicobacter pylori Rif2]
Sequence
MRLSNADLERLKSMANALRFLCADMIDKANSGHPGVCLGLADVMVVLSLHLNLNPTNPKW
LNRDRLVFSGGHASALAYSLLHLWGFDLSLEDLKRFRQLHSKTPGHPELHHTEGIEITTG
PLGQGFANAVGFSMASQYAQNLLDKEAISHKVYCLCGDGDLQEGISYESASLAGHLRLDN
LIVIYDSNQISIEGAINISFSEQVKTRFVAQNWEVLECDGHDYQAIHNALEEAKKSTKPT
LLIAHTIIGKGAVGLEGSEKTHGSPLNKEVLKQSKENAQINPNESFIISPKNKMHFEEVK
VRGVSLEALWEKSLSPKIKEKIHALKDFDFSAIHYPTFKKGESLATRVSNGMILNAIAKE
CEGFLGGSADLAPSNNTQLKHSGDFPLGQNLHFGIREHAMGAITNALAAYGLFVPFCATF
FVFSDYLMPSIRLSALMKLKALFIFTHDSIGVGEDGATHQPIEQLNHLRALPNFYAFRPS
DAFENTACMQIALSLNAPSGLILSRQNLPVLDEVSKERVLKGAYVKHHSKDPIITLVASG
SEVSLALESAKILERENIQTQVISAPCFDLLIEQDESYLKELFKGKVLVIEASRAIEWYR
FADKIIGMDSFGSSAKGDKLFEKFGFSVENITAQAKRLLNA
Download sequence
Identical sequences A0A1Y3E0C9 A0A2J9KI61 O25720
NP_207879.1.64343 WP_001239827.1.100370 WP_001239827.1.12929 WP_001239827.1.14785 WP_001239827.1.15441 WP_001239827.1.15770 WP_001239827.1.16964 WP_001239827.1.18045 WP_001239827.1.21161 WP_001239827.1.21640 WP_001239827.1.23346 WP_001239827.1.26233 WP_001239827.1.26656 WP_001239827.1.27034 WP_001239827.1.29892 WP_001239827.1.30129 WP_001239827.1.32874 WP_001239827.1.32920 WP_001239827.1.32991 WP_001239827.1.34734 WP_001239827.1.34950 WP_001239827.1.37759 WP_001239827.1.3847 WP_001239827.1.3935 WP_001239827.1.45388 WP_001239827.1.45788 WP_001239827.1.46484 WP_001239827.1.47666 WP_001239827.1.51993 WP_001239827.1.53728 WP_001239827.1.54470 WP_001239827.1.56818 WP_001239827.1.5696 WP_001239827.1.58727 WP_001239827.1.61092 WP_001239827.1.63400 WP_001239827.1.64394 WP_001239827.1.65101 WP_001239827.1.65885 WP_001239827.1.66907 WP_001239827.1.6783 WP_001239827.1.71453 WP_001239827.1.71693 WP_001239827.1.74411 WP_001239827.1.7512 WP_001239827.1.76964 WP_001239827.1.77110 WP_001239827.1.77453 WP_001239827.1.78022 WP_001239827.1.78855 WP_001239827.1.79031 WP_001239827.1.79522 WP_001239827.1.81922 WP_001239827.1.84468 WP_001239827.1.85386 WP_001239827.1.85662 WP_001239827.1.85747 WP_001239827.1.87485 WP_001239827.1.88001 WP_001239827.1.88687 WP_001239827.1.8903 WP_001239827.1.94773 WP_001239827.1.95955 WP_001239827.1.97942 WP_001239827.1.98792 WP_001239827.1.98910 WP_001239827.1.990 gi|15645702|ref|NP_207879.1| gi|410502082|ref|YP_006936609.1| 85962.HP1088 gi|410024316|ref|YP_006893569.1| gi|15645702|ref|NP_207879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]