SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209696168|ref|YP_002264098.1| from Aliivibrio salmonicida LFI1238

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209696168|ref|YP_002264098.1|
Domain Number 1 Region: 24-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.73e-95
Family Methylenetetrahydrofolate reductase 0.000000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209696168|ref|YP_002264098.1|
Sequence length 298
Comment 5,10-methylenetetrahydrofolate reductase [Aliivibrio salmonicida LFI1238]
Sequence
MAYSHASHLESLNQNIAELNGCINVSFEFFPPSSEKMEETLWNSIHRLKTLKPKFVSVTY
GANSGERDRTHSIIKEIKEQTGLIAAPHLTCIDASRSELIDIANDYWANGIKDIVALRGD
IPAGGGAPDMYASDLVELLKSQHDFDISVAAFPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQASRFAKMNNVRIPGWMAQQFE
GLDDDPVTRQMVGASHAIDMTRILSREGVKDFHFYTLNRAEHTYALCHTLGVRPDVNR
Download sequence
Identical sequences A0A1B9P2X7 B6EMP2
316275.VSAL_I2762 gi|209696168|ref|YP_002264098.1| WP_012551199.1.33597 WP_012551199.1.35969 WP_012551199.1.50441 WP_012551199.1.77666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]