SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218901593|ref|YP_002449427.1| from Bacillus cereus AH820

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218901593|ref|YP_002449427.1|
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.5e-18
Family SinR domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218901593|ref|YP_002449427.1|
Sequence length 64
Comment DNA-binding protein [Bacillus cereus AH820]
Sequence
MKNQIYELRTENNISQGALADKCKVSRQTINAIENNKYDPSLALAFRLAEVLGTTVDKLF
LYKQ
Download sequence
Identical sequences A0A023P295 A0A063CF26 A0A0B6BJ92 A0A0D1PP39 A0A0F5RKM9 A0A0F6FRU1 A0A0G4D8Z0 A0A0J1HRB7 A0A0K0S2C8 A0A0K6MFW6 A0A0Q9GWE9 A0A0Q9H0B3 A0A0T8F954 A0A0W7Y3T2 A0A135W3F5 A0A158RMP8 A0A160L6E9 A0A1J9ZGE1 A0A243MQZ3 B3ZAN6 B3ZQ55 B5UIN4 B7H7J1 B7HT87 B7IVU5 B7JN87 C2MVE7 C2NTP5 C2Q6U7 C2U8S7 C2X6N4 C3DEL8 C3GVY5 D8GZS0 J3ZUP3 J8FRM9 J8GCS3 M1PEU0 N1LV25 Q81IF3 Q81Z81 R8C172 R8ICC8 V5M3H1 W8XXL4
gi|434379053|ref|YP_006613697.1| NP_830274.1.86172 NP_842935.1.87267 WP_000795762.1.101843 WP_000795762.1.11387 WP_000795762.1.13299 WP_000795762.1.1354 WP_000795762.1.33536 WP_000795762.1.40430 WP_000795762.1.4447 WP_000795762.1.46864 WP_000795762.1.47975 WP_000795762.1.5628 WP_000795762.1.6743 WP_000795762.1.6753 WP_000795762.1.7628 WP_000795762.1.76883 WP_000795762.1.79043 WP_000795762.1.84614 WP_000795762.1.91615 WP_000795762.1.9269 WP_000795762.1.97149 gi|227813061|ref|YP_002813070.1| gi|218233192|ref|YP_002365235.1| gi|402554012|ref|YP_006595283.1| gi|558678769|ref|YP_008816898.1| gi|296501215|ref|YP_003662915.1| gi|30260558|ref|NP_842935.1| gi|218901593|ref|YP_002449427.1| gi|452196760|ref|YP_007476841.1| gi|384184466|ref|YP_005570362.1| gi|301052106|ref|YP_003790317.1| gi|30018643|ref|NP_830274.1| gi|376264408|ref|YP_005117120.1| gi|229601629|ref|YP_002865007.1| 198094.BA_0391 226900.BC0435 261594.GBAA0391 405531.BCG9842_B4867 405532.BCB4264_A0457 405534.BCAH187_A0505 405535.BCAH820_0435 568206.BAMEG_0459 572264.BCA_0472 592021.BAA_0455 gi|449087181|ref|YP_007419622.1| gi|218895509|ref|YP_002443920.1| gi|217957986|ref|YP_002336530.1| gi|225862432|ref|YP_002747810.1| gi|375282523|ref|YP_005102960.1| gi|402562518|ref|YP_006605242.1| gi|47777808|ref|YP_017011.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]