SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|565639445|ref|YP_008891688.1| from Acinetobacter baumannii ZW85-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565639445|ref|YP_008891688.1|
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 6.93e-140
Family ArgJ-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|565639445|ref|YP_008891688.1|
Sequence length 406
Comment glutamate N-acetyltransferase/amino-acid acetyltransferase [Acinetobacter baumannii ZW85-1]
Sequence
MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSNVAGVFTQNAFCAAPVH
VSKAHLAQGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAELAGVNSFEVLPFSTGVIG
EQLPMERLLAGLQPALNSVQDAAWSDAASGIMTTDTVPKGASEQFELDGMTYTMTGISKG
AGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSFNRITIDGDTSTNDSCIFVATGQ
AGGAEITSESDVRYAKVLEVLARVMNRLAQLIVRDGEGATKFITVAVEGGANTQECCDIA
YSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKIQVWLDDVQICKDGGAAEDYT
EEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences A0A1C4HFY5 N9J661
WP_005129596.1.11019 WP_005129596.1.28246 WP_005129596.1.37807 WP_005129596.1.41026 WP_005129596.1.42377 WP_005129596.1.53144 WP_005129596.1.64177 WP_005129596.1.65527 WP_005129596.1.69609 WP_005129596.1.71005 WP_005129596.1.7947 WP_005129596.1.83679 WP_005129596.1.85254 WP_005129596.1.89412 WP_005129596.1.92665 gi|565639445|ref|YP_008891688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]