SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|565643436|ref|YP_008894733.1| from Acinetobacter baumannii ZW85-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565643436|ref|YP_008894733.1|
Domain Number 1 Region: 20-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-17
Family RecA protein-like (ATPase-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 220-339,526-578
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.94e-16
Family Intein (protein splicing domain) 0.01
Further Details:      
 
Domain Number 3 Region: 337-515
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000000085
Family Group I mobile intron endonuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|565643436|ref|YP_008894733.1|
Sequence length 732
Comment recA protein [Acinetobacter baumannii ZW85-1]
Sequence
MEPNLSALADDLEKLIGDNEETQTVTNWLDTGDPELNFAISGRYDGGIPYGRIVEMYGPP
SSGKTAEATDLMIRAQEAGGIAMFFDWERSFDINLAKNLGLKTERPFWIYKKPETWEEGN
VLAMRAVELIRNSATIPDDAPIICVFDSVASAIPQSVYYDNKGKKREIDTFNMSDNTALA
RASSTSLKVIAQTAEKYNATFLYLNQQRTKIGVMFGDPTCLRAEVQVPFVDGTSATMKQI
VDGKISKEVWSWNEVSGQLEPKRIIGWHNNGSIKGTDKEWYHIRAVCPETRNGLVAVSGT
NDHKVQVKDKGWINFSDVRVGDYVITRTKRTFAGTALEFLKGLIGFDSHMARVSSQRQTA
ALIIQDNENPEYAQWKVDLLSRHLNFVKREITISKGNKGHRYESCYTHELMKFYDLCRCP
HTLFKDGWTPMQLAIAVMDDGNYKESSKTLNLSFKRLRGCEDELDAIGQSLYQSFGLTYD
IRYGQGRIDFDVKGTAKIAELIAQYVPDCMQYKLPIEYRGRYVALELDAPVDESVVHYAE
VTEMRLGSKNKGSVMYDITVEDNHNFLAGNTHNGFLVHNCTPGGSSFEYYASVRIALGRT
KLMETVNGKKQFVGQDIATKIVKTKLTKPFQETTMRMWFDKNGVAFFDRHYNLVEFLKAK
GILKQSGAYIEWTDGKKYHLKSLCDKLKADPTGLQQLRALIPKISPSADDIEVTPLMSNE
DELEALYSDDAC
Download sequence
Identical sequences A0A1S2FXJ7
gi|565643436|ref|YP_008894733.1| gi|565643436|ref|YP_008894733.1|NC_023031 WP_023897604.1.11500 WP_023897604.1.12703 WP_023897604.1.16082 WP_023897604.1.43088 WP_023897604.1.64177 WP_023897604.1.72577 WP_023897604.1.75628 WP_023897604.1.85306 WP_023897604.1.90399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]