SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|206900614|ref|YP_002250770.1| from Dictyoglomus thermophilum H-6-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206900614|ref|YP_002250770.1|
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily Hsp33 domain 8.24e-68
Family Hsp33 domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 233-290
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 4.97e-18
Family HSP33 redox switch-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206900614|ref|YP_002250770.1|
Sequence length 295
Comment chaperonin HslO [Dictyoglomus thermophilum H-6-12]
Sequence
MDYLIRGLSKDKRIVAYVAKTTDLVEQARQIHKASPTAIAALGRTLTLAAIMGKMLKKDE
ERISLQITGNGPLGNIFAEADSKGNVRGFIKRAYIDLPPTPDGKLDVPSAIGKEGTLSVI
RDLGLKEPYRGVVPIVSGGIAKDLAYYFTYSEQLPSAVAAGVYVSKEGKVISAGGYIVQI
MESAEKDIIDILETNIKNLDPPSKMILDGQSPEEIMSRIFKNIEYEQFSREDLKYACRCS
RERAENTLIALGVKELEELIKNEEFIEVKCEFCGKTYTFDKRDMEEIINQLKNKT
Download sequence
Identical sequences B5YE12
gi|206900614|ref|YP_002250770.1| WP_012547407.1.10127 309799.DICTH_0908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]