SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206900617|ref|YP_002250279.1| from Dictyoglomus thermophilum H-6-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206900617|ref|YP_002250279.1|
Domain Number 1 Region: 2-249,325-355
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.77e-94
Family Type II chitinase 0.00000397
Further Details:      
 
Domain Number 2 Region: 249-324
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000549
Family Chitinase insertion domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206900617|ref|YP_002250279.1|
Sequence length 372
Comment chitinase A1 [Dictyoglomus thermophilum H-6-12]
Sequence
MPQKRVVAYFPEWKVRDEYLGYSIEDIPWKFLTHINYAFAKIVDGKVHPIDENLFYSNMK
KIKEFKKEYKKVKVLISVGGWTDSGEFSDVALTEENRRKFAKSALELIKEFNLDGIDIDW
EFPVSGGLPTNKARPEDKENFTLLLKTLREVLSEENKDLLLTIAAPASYTQIHNTEPDKY
HVFLDFINLMTYDFHGVWDKYTNHHSPLYGTPKDPDEKSRERANCDSAVREYLKFKVPSE
KIVLGVPFYGKGWICEDEGYNGLFAKVKGIPYGIFDSEGHPSGSNPFFFIRGVLENDPDY
IKFRDEYAKVPWLWNPKEKIMYSYDDEESISEKCDYVIKNNLGGIMFWEVTQDYPFKGYT
LVELIHNKLMEG
Download sequence
Identical sequences B5YCM1
WP_012547410.1.10127 gi|206900617|ref|YP_002250279.1| 309799.DICTH_0397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]