SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206900892|ref|YP_002250716.1| from Dictyoglomus thermophilum H-6-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206900892|ref|YP_002250716.1|
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.04e-35
Family Ribosomal protein L6 0.0000407
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.49e-26
Family Ribosomal protein L6 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|206900892|ref|YP_002250716.1|
Sequence length 180
Comment 50S ribosomal protein L6 [Dictyoglomus thermophilum H-6-12]
Sequence
MSRIGKKPVPIPQNVQVEIKDGNCVLVKGPLGQLEKTFSPLLTIKKVDNQIVVERPNDEK
FVKALHGLTRALINNMVLGVTQGFEKRLELQGTGYRARVQGNKLILEVGFSHPVELEIPT
GLTVTVQDNTKISVKGIDKELVGQFAAIVRSVRPAEPYKGKGIRYEGEKIRQKAGKAGKK
Download sequence
Identical sequences B5YDV8
gi|206900892|ref|YP_002250716.1| 309799.DICTH_0852 WP_012547685.1.10127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]