SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206901988|ref|YP_002250586.1| from Dictyoglomus thermophilum H-6-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206901988|ref|YP_002250586.1|
Domain Number 1 Region: 18-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.41e-45
Family PP-loop ATPase 0.00037
Further Details:      
 
Domain Number 2 Region: 357-447
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.75e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 213-293
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000994
Family MesJ substrate recognition domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206901988|ref|YP_002250586.1|
Sequence length 455
Comment tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Dictyoglomus thermophilum H-6-12]
Sequence
MTKDISNLDYIEKKVLDFIKSESLISQGDSIILSVSGGSDSIALSEILYNLSSILNLNLY
IVYIDHHVRSNTYIEKEIIKDYATSRSIPYSFLDIYTTDFTEKTLREERYKALIKFSEKI
KFNKIALGHTLDDQIETIIMSFFKGYGIEGLCGIPTKRDNFIRPIIILSKEEILEYCKRK
NLKYVDDFTNLLPITLRNRIRYQLIPFLKENIPQFPQSIISQSVILSIENDLLEKLSKKY
FDGLKRSNNVIEIENEGWKLLHDAIKIRVLKEIFKNFNEELSNEAIFYILREMSIMEGSK
TLEIGNTEIYLYNQKIYIYKKEKHEFIIILPIPGEVKLPTGEILKAELIRNEGEPFNFKD
LWHAYFDYDKIKAKELIVRNWKEGDRIEPFGLEGKSKKVQDVFVDKKIPKWKRKIIPLVT
YKDKILWIPGVIRSDIAKVTNDTQTILHLSLKKEV
Download sequence
Identical sequences B5YDH8
WP_012548781.1.10127 gi|206901988|ref|YP_002250586.1| 309799.DICTH_0715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]