SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|206901214|ref|YP_002251353.1| from Dictyoglomus thermophilum H-6-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206901214|ref|YP_002251353.1|
Domain Number 1 Region: 27-177
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.00000167
Family PA0094-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206901214|ref|YP_002251353.1|
Sequence length 179
Comment hypothetical protein DICTH_1537 [Dictyoglomus thermophilum H-6-12]
Sequence
MRKLLRFLIFSLLVLGLSFNIILAETEKYVDKDLGFSIVPPEGWEVKDGKPYNLAVIFVG
PADEGFMPNFNLNIVAVPSEVTEINEDLLREIKEELKAAGEYYGSLEFVSEGEREVSNYK
GYEIVYTINLSEDLTLEQKQVYVLQGGKFYIFTFTSLEDTFEKYLPLFEESLSTFEILQ
Download sequence
Identical sequences B5YA83
309799.DICTH_1537 gi|206901214|ref|YP_002251353.1| WP_012548007.1.10127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]