SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|213158405|ref|YP_002319703.1| from Acinetobacter baumannii AB0057

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213158405|ref|YP_002319703.1|
Domain Number 1 Region: 631-804
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.37e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 2-186
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0048
Further Details:      
 
Domain Number 3 Region: 145-304
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.6e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0056
Further Details:      
 
Domain Number 4 Region: 500-639
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.27e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Weak hits

Sequence:  gi|213158405|ref|YP_002319703.1|
Domain Number - Region: 338-383
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0189
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|213158405|ref|YP_002319703.1|
Sequence length 848
Comment nitrite reductase [NAD(P)H], large subunit [Acinetobacter baumannii AB0057]
Sequence
MKLVMIGHGMVGHKFIEAILEKADDELEITILAEEPRIAYDRVHLTEYFSGKSAKDLSLA
RFDFADAYGIDLRLNTKAVAIDTTAQTVTTNHGDVISYDKLVLATGSYAFVPPIPGNDRE
NCFVYRTIEDLDAIRAASLKAKTGVVIGGGLLGLEAAKALRDLDLETHVVEFAPRLMAVQ
IDDLGGKVLRRKIEDLGVKVHTQKATQSIESGVNTTHVMKFADGSELETDVILFSAGIRP
RDELARNSGLAIGERGGIVINDYCQTSDQNIYAIGECALWQNKIYGLVAPGYDMARIAAK
HILDEECHCFAGADMSTKLKLMGVDVASVGDAHAMTPGALSYFYADEHALVYKKIVVNAD
KTKLLGAVLVGDAKEYNDLLQMMLNGLALPEVPESLIMPGFEQSAAKSGGSGVDLLPDSA
TICSCNNVSKADICQAISDGSTSLGALKKCTKAATACGGCAPLVTQVLKSELQRQGVTVN
NHICEHFPYSRQELYHLVRVNEIKTFDDLIHQHGHGLGCDICKPAAANILASCWNDFVLK
PSHAGLQDSNDYYLGNIQKDGSYSIVPRMAGGEVTPDGLIAIGQIAKKYNLYTKITGGQR
VDMFGAQVHELPFIWEELNAAGFESGHAYGKSLRTVKSCVGSTWCRYGVDNSVGLAIELE
NRYKGLRSPHKLKMAVSGCTRECAEAQGKDVGVIATEKGWNLYVCGNGGMKPRHAELLAS
DLDKETLIRYIDRFFMFYIQTADRLQRTSVWRDNMEGGLDYLKSVIVDDSLGLAAELERR
MEHIIGTYQDEWRTAVENPEVRKRFQTYINAGANEQADPHIQFTTERGQIRPLTEAERSE
DRIPMVEA
Download sequence
Identical sequences A0A062FXW1 A0A062IG01 A0A062MW64 A0A090B2S3 A0A0J1AAZ8 L9P3L9 N9I1I7 N9JKM4
gi|215483137|ref|YP_002325344.1| gi|213158405|ref|YP_002319703.1| WP_000780182.1.100152 WP_000780182.1.100864 WP_000780182.1.101338 WP_000780182.1.101409 WP_000780182.1.11724 WP_000780182.1.13480 WP_000780182.1.13635 WP_000780182.1.13675 WP_000780182.1.13850 WP_000780182.1.14637 WP_000780182.1.14915 WP_000780182.1.15066 WP_000780182.1.15428 WP_000780182.1.16288 WP_000780182.1.16343 WP_000780182.1.16398 WP_000780182.1.16701 WP_000780182.1.16787 WP_000780182.1.16850 WP_000780182.1.17002 WP_000780182.1.1753 WP_000780182.1.18499 WP_000780182.1.1863 WP_000780182.1.18701 WP_000780182.1.19092 WP_000780182.1.20066 WP_000780182.1.20172 WP_000780182.1.21167 WP_000780182.1.21342 WP_000780182.1.21798 WP_000780182.1.23674 WP_000780182.1.24586 WP_000780182.1.2475 WP_000780182.1.26151 WP_000780182.1.26921 WP_000780182.1.2722 WP_000780182.1.27656 WP_000780182.1.28236 WP_000780182.1.28581 WP_000780182.1.28689 WP_000780182.1.29461 WP_000780182.1.29672 WP_000780182.1.29779 WP_000780182.1.29927 WP_000780182.1.30597 WP_000780182.1.31121 WP_000780182.1.32223 WP_000780182.1.3225 WP_000780182.1.32532 WP_000780182.1.32666 WP_000780182.1.33308 WP_000780182.1.33423 WP_000780182.1.34917 WP_000780182.1.35434 WP_000780182.1.36122 WP_000780182.1.37180 WP_000780182.1.37345 WP_000780182.1.37386 WP_000780182.1.37406 WP_000780182.1.3836 WP_000780182.1.39159 WP_000780182.1.41878 WP_000780182.1.43088 WP_000780182.1.43766 WP_000780182.1.44058 WP_000780182.1.44964 WP_000780182.1.45239 WP_000780182.1.4548 WP_000780182.1.45608 WP_000780182.1.46080 WP_000780182.1.46553 WP_000780182.1.46887 WP_000780182.1.47219 WP_000780182.1.47436 WP_000780182.1.47607 WP_000780182.1.48527 WP_000780182.1.49410 WP_000780182.1.49463 WP_000780182.1.49938 WP_000780182.1.5 WP_000780182.1.50111 WP_000780182.1.50216 WP_000780182.1.51314 WP_000780182.1.51709 WP_000780182.1.52310 WP_000780182.1.52342 WP_000780182.1.52806 WP_000780182.1.53703 WP_000780182.1.54138 WP_000780182.1.54464 WP_000780182.1.54492 WP_000780182.1.54885 WP_000780182.1.54906 WP_000780182.1.55408 WP_000780182.1.55447 WP_000780182.1.55457 WP_000780182.1.56154 WP_000780182.1.5626 WP_000780182.1.56690 WP_000780182.1.58570 WP_000780182.1.58802 WP_000780182.1.59802 WP_000780182.1.59944 WP_000780182.1.60109 WP_000780182.1.60484 WP_000780182.1.60542 WP_000780182.1.60678 WP_000780182.1.61173 WP_000780182.1.61759 WP_000780182.1.6221 WP_000780182.1.62242 WP_000780182.1.62435 WP_000780182.1.62800 WP_000780182.1.62817 WP_000780182.1.6289 WP_000780182.1.63224 WP_000780182.1.63537 WP_000780182.1.63649 WP_000780182.1.63906 WP_000780182.1.64044 WP_000780182.1.64586 WP_000780182.1.64646 WP_000780182.1.65154 WP_000780182.1.65506 WP_000780182.1.6557 WP_000780182.1.65970 WP_000780182.1.66771 WP_000780182.1.66972 WP_000780182.1.67003 WP_000780182.1.67823 WP_000780182.1.68086 WP_000780182.1.68705 WP_000780182.1.68904 WP_000780182.1.69859 WP_000780182.1.70297 WP_000780182.1.70461 WP_000780182.1.70993 WP_000780182.1.71131 WP_000780182.1.71347 WP_000780182.1.7172 WP_000780182.1.72299 WP_000780182.1.72577 WP_000780182.1.73056 WP_000780182.1.73238 WP_000780182.1.7330 WP_000780182.1.73737 WP_000780182.1.73874 WP_000780182.1.74318 WP_000780182.1.74322 WP_000780182.1.74949 WP_000780182.1.75478 WP_000780182.1.75620 WP_000780182.1.75896 WP_000780182.1.7651 WP_000780182.1.76571 WP_000780182.1.76585 WP_000780182.1.77396 WP_000780182.1.77812 WP_000780182.1.78094 WP_000780182.1.78197 WP_000780182.1.78530 WP_000780182.1.78904 WP_000780182.1.78984 WP_000780182.1.79254 WP_000780182.1.79789 WP_000780182.1.80138 WP_000780182.1.8108 WP_000780182.1.81146 WP_000780182.1.82036 WP_000780182.1.82355 WP_000780182.1.82404 WP_000780182.1.82633 WP_000780182.1.83297 WP_000780182.1.8389 WP_000780182.1.839 WP_000780182.1.84099 WP_000780182.1.85449 WP_000780182.1.85683 WP_000780182.1.87319 WP_000780182.1.88040 WP_000780182.1.89033 WP_000780182.1.89643 WP_000780182.1.90399 WP_000780182.1.90795 WP_000780182.1.91199 WP_000780182.1.91241 WP_000780182.1.91906 WP_000780182.1.92611 WP_000780182.1.92745 WP_000780182.1.93437 WP_000780182.1.93485 WP_000780182.1.93570 WP_000780182.1.94012 WP_000780182.1.94129 WP_000780182.1.94581 WP_000780182.1.9472 WP_000780182.1.95001 WP_000780182.1.95172 WP_000780182.1.95363 WP_000780182.1.96119 WP_000780182.1.96966 WP_000780182.1.97300 WP_000780182.1.97661 WP_000780182.1.98666 WP_000780182.1.98769 WP_000780182.1.99395 WP_000780182.1.99429 WP_000780182.1.99770 480119.AB57_2353 557600.ABBFA_001441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]