SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189485299|ref|YP_001956240.1| from uncultured Termite group 1 bacterium phylotype Rs-D17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189485299|ref|YP_001956240.1|
Domain Number 1 Region: 205-385
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.1e-65
Family B3/B4 domain of PheRS, PheT 0.0000161
Further Details:      
 
Domain Number 2 Region: 41-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.15e-38
Family Myf domain 0.003
Further Details:      
 
Domain Number 3 Region: 461-678
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.96e-23
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00086
Further Details:      
 
Domain Number 4 Region: 690-790
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.97e-22
Family Anticodon-binding domain of PheRS 0.0015
Further Details:      
 
Domain Number 5 Region: 399-469
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.29e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189485299|ref|YP_001956240.1|
Sequence length 791
Comment phenylalanyl-tRNA synthetase beta subunit [uncultured Termite group 1 bacterium phylotype Rs-D17]
Sequence
MKLSYKWLKKFIDFELSPQELASMLISVGIETSVVSTGCDWHSVVTVKVLEVLKHPGADR
LSLCKVNDGSKDYSIVCGAKNIAAGQIVPLAKIGAVLPGNFKINKSKIRGIVSEGMICSE
ADLGLKKESDGILMLDKNTKIGVALENVLSGLDSILEIEITTNRGDCLSHLGVAREIGAK
LRKILSFPTMIKTFNIPYLNCVEVKSDLCHRYIGSVISGVKICPSPGWITDALEKSGIRP
VNNVVDVTNYVMIELGQPLHTFDITKLSSRKVVVRKAVDYEKIIALDGKEYKLDSEMLVI
ADSEKPVAIAGVMGGEYSAIDEKTETVFLESAIFDAVSIRKTSKKLNLSSGSSYRFERGL
GWDITELASWRAANLIIEIAGGRMDAREDLQIVKYERADIALRVEKVSKILGCVVKEAEI
TEILRFLGIDLRSRGTIILCTVPSWRNDIKKEVDLIEEIARIKGYDAITSPGKRCTATAE
VCVSDNSLLHAVVEEFRVKLNGFSFSEVLNYSFSEITELEKFDLKYYYKIANPISKENEV
LRPSLLPALYKNLLLNIEWGSETVTLFEYGKIFTGLGERKAFAVIMYGKVWQEWWKWAEQ
KNSPKYDFYFGGGIVRNILPSDEFIIAENLNAESYYHSGKTASVVYKGKPVGQFGVLKPS
ITSDIAGDVFYFEVNLESFENVCAGKKSLYKAYSKFPEVKRDISITADKTLQFSEIEKVI
KNVIKSGGILKEYSLFSVYSDESKVGDGKISYSFRLSYKNSEKTLTNEEVNKDMNVLLQK
LDADFGVKLRR
Download sequence
Identical sequences B1GZU7
gi|189485299|ref|YP_001956240.1| 471821.TGRD_296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]