SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189485588|ref|YP_001956529.1| from uncultured Termite group 1 bacterium phylotype Rs-D17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189485588|ref|YP_001956529.1|
Domain Number 1 Region: 20-202
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.92e-26
Family Hypothetical protein TM0269 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189485588|ref|YP_001956529.1|
Sequence length 209
Comment putative cobalamin-dependent methionine synthase [uncultured Termite group 1 bacterium phylotype Rs-D17]
Sequence
MLRISTIEIPYNKLLVRLGYLQTKTKLDEKTAVMIKETLSLAQKLIKPKAVVAFENIATI
SGNKTSNEISFENGYKIKSGNIAKLLKNCFKVYGIGITVGGALELRIDEFLKKKETFNAL
ISDAAGSVAAEETINLANAQIKAYEEKNGNMVTRRYSPGYGDWILEDNRQFLNWIGAEHI
GIKLNEFCHMKPEKSVSALIGVAKGWSER
Download sequence
Identical sequences B1H0N6
gi|189485588|ref|YP_001956529.1| 471821.TGRD_585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]