SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189485709|ref|YP_001956650.1| from uncultured Termite group 1 bacterium phylotype Rs-D17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189485709|ref|YP_001956650.1|
Domain Number 1 Region: 4-284
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-70
Family Methylenetetrahydrofolate reductase 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189485709|ref|YP_001956650.1|
Sequence length 287
Comment 5,10-methylenetetrahydrofolate reductase [uncultured Termite group 1 bacterium phylotype Rs-D17]
Sequence
MRLKFKEKLKSDKFLITAELFPPKGVDISSFLRRADCLYGLDAVNVTDNQRASMRVSSLA
MSRILIERAIEPILQLTARDRNRISLQSELLGANVLGIENVLLLSGDHPSIGECSDAKAV
YDLDTIQLIKTARLLETGVDIAGKKLQGSPKFCVGAVVNPSVQSVDLQALMLEKKVKAGT
EFFQTQAIFDVQIYKNFFDKVKHLKVKILPGMILIKSPKFLQFLKSMSGVNIPDEIKDRI
NSASDPLAESIKICSATIKELRSFADGVHIMAIGTEEHIPEMIRDSL
Download sequence
Identical sequences A0A1C9ZSY0 B1GYU6
471821.TGRD_706 gi|189485709|ref|YP_001956650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]