SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206889480|ref|YP_002248518.1| from Thermodesulfovibrio yellowstonii DSM 11347

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206889480|ref|YP_002248518.1|
Domain Number 1 Region: 2-293
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-67
Family Methylenetetrahydrofolate reductase 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|206889480|ref|YP_002248518.1|
Sequence length 295
Comment methylenetetrahydrofolate reductase family protein [Thermodesulfovibrio yellowstonii DSM 11347]
Sequence
MSNLRKRLMSGDFVITVEITPPKGPDITGMVKKLEELKTMVDAVNFTDNPSARMRLCSLA
ACKLSMDIGFEPVLQMACRDRNRLAIQSDLLGAHALGIRNLLVMTGDHPVWGDHREAKPV
YDIDSSILVKLVGNLNSGLDINGNKLNGKTEFFCGAVVNPNAEPLMPQLKRFEQKLKMGA
EFFQTQMIFEIEKLERFIDYSKKFNTKVIAGIVLIRTKKMLHYLASKVPGVVMPSWLIDK
IERLNDEDVEKFGVDFAGSIILNLMERKLCDGVHIMAFSKVEEVKNLLDFLKIRM
Download sequence
Identical sequences B5YJV3
289376.THEYE_A0676 gi|206889480|ref|YP_002248518.1| YP_002248518.1.25208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]