SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206889551|ref|YP_002249216.1| from Thermodesulfovibrio yellowstonii DSM 11347

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206889551|ref|YP_002249216.1|
Domain Number 1 Region: 84-283
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.66e-68
Family B3/B4 domain of PheRS, PheT 0.0000129
Further Details:      
 
Domain Number 2 Region: 356-585
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00014
Further Details:      
 
Domain Number 3 Region: 593-691
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.49e-30
Family Anticodon-binding domain of PheRS 0.00076
Further Details:      
 
Domain Number 4 Region: 1-77
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.66e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.00069
Further Details:      
 
Domain Number 5 Region: 292-364
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|206889551|ref|YP_002249216.1|
Sequence length 692
Comment phenylalanyl-tRNA synthetase subuit beta [Thermodesulfovibrio yellowstonii DSM 11347]
Sequence
MKVPFSWLTEYIEGEIELKRTSDALTMAGLEVGAIEEFDSDTVLDLEITPNRADCLSIIG
IAREIKAIFGLKLKKPSFKIKKELKDNKFTISIANPELCYRYAGRIVRDVKISPSPQWLK
KRLEASGIRSINNVVDITNYVLLEYGHPLHAFDLDRLEGYQIRVGTPEAFRKSIEEIVTL
DGVKRKINHDDLLIWDGVKPVAVAGIMGGANTEVTDKTTNILIESAYFKPERIRKTSKRL
GISTEASYRFERGTDIETLKEALDRAAFLIQELTGGTVYEAIDVYPVKIPEKKILFSMEK
ICKFIGVTLKDKEVLRILELLEINVTKKDEKFYIASIPTHRQDLAIEEDIAEEVARIYGY
DTIPAQMPSAFKYVTENHELTKKRKFLNLIRDYLISLGYSEAVNFSFMSPDDLNVFGISE
NDIRRHYISLVNPLRQEESIMRTMLLPSLLKNTEKNTARGIENLRLFEIGKVFIAQEGAS
LPQEIVHLGIITKKEEIKSSFKDDPYDFYALKGLIEGVFRHFKINNIRYIRSNEVFLHPG
QSADILIKGEKIGFIGVISPEVLSKLDFKTKPFICMAEIDLNRLFSFAEAEIKYKPFSTY
PAVKRDTALILPIDFESQRIFDIIKSFDNELIENVFIFDVYQGKGIPEGKKSIAFRITYR
ASDRTLTAEEVENIHNNLIGKIIAETGAALRI
Download sequence
Identical sequences B5YG18
YP_002249216.1.25208 289376.THEYE_A1416 gi|206889551|ref|YP_002249216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]