SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206890406|ref|YP_002248172.1| from Thermodesulfovibrio yellowstonii DSM 11347

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206890406|ref|YP_002248172.1|
Domain Number 1 Region: 31-92
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000109
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|206890406|ref|YP_002248172.1|
Domain Number - Region: 99-125
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|206890406|ref|YP_002248172.1|
Sequence length 165
Comment serine/threonine protein kinase [Thermodesulfovibrio yellowstonii DSM 11347]
Sequence
MKKILYIAGAIFAGFLAGYLSLTLFVSGGTIEVPDLRGKDIVQANQILKEKGLYIRIDGE
EYSDIPTGTVSRQSLPAGTKVKKGREVGVIMSKGLKFTVFPDVRGVSYEEAEKILNEKGI
PIEKVIKIHSNKYPDNIVIAQSPEPQQGGKAIKLIVSIGEKEEEK
Download sequence
Identical sequences B5YIL3
WP_012546118.1.25233 YP_002248172.1.25208 gi|206890406|ref|YP_002248172.1| 289376.THEYE_A0325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]