SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218691385|ref|YP_002399597.1| from Escherichia coli ED1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218691385|ref|YP_002399597.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.69e-109
Family FMN-linked oxidoreductases 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.65e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000000312
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.25e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218691385|ref|YP_002399597.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase, NADH and FMN-linked [Escherichia coli ED1a]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDANQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVGAVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQSFDETILASGIVPRIPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAEFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A029IJT7 A0A234YM65 B7N084
gi|218691385|ref|YP_002399597.1| WP_000121410.1.16608 WP_000121410.1.20784 WP_000121410.1.25248 WP_000121410.1.32518 WP_000121410.1.33046 WP_000121410.1.33190 WP_000121410.1.35253 WP_000121410.1.37608 WP_000121410.1.40083 WP_000121410.1.40153 WP_000121410.1.42677 WP_000121410.1.43942 WP_000121410.1.44447 WP_000121410.1.47024 WP_000121410.1.47349 WP_000121410.1.53687 WP_000121410.1.62555 WP_000121410.1.64547 WP_000121410.1.69438 WP_000121410.1.76019 WP_000121410.1.76237 WP_000121410.1.85554 WP_000121410.1.98757 585397.ECED1_3749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]