SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330832861|ref|YP_004401686.1| from Streptococcus suis ST3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330832861|ref|YP_004401686.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.57e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330832861|ref|YP_004401686.1|
Sequence length 105
Comment lactose-specific phosphotransferase system (PTS), IIA component 1 [Streptococcus suis ST3]
Sequence
MNREEITLLGFEIVAFAGDARSRLMEALAAAQKGDYAKAEELVEAANACIVEAHHAQTSL
LQKEAAGEDLAFSVTLMHGQDHLMTTLLLKDMMGHMIELYKRGDK
Download sequence
Identical sequences A0A0K2E5T5
WP_002935220.1.100661 WP_002935220.1.100670 WP_002935220.1.100908 WP_002935220.1.101829 WP_002935220.1.101901 WP_002935220.1.101939 WP_002935220.1.10539 WP_002935220.1.11527 WP_002935220.1.12665 WP_002935220.1.13212 WP_002935220.1.1370 WP_002935220.1.14775 WP_002935220.1.15374 WP_002935220.1.16677 WP_002935220.1.17649 WP_002935220.1.18076 WP_002935220.1.19097 WP_002935220.1.19145 WP_002935220.1.1918 WP_002935220.1.19625 WP_002935220.1.1991 WP_002935220.1.20983 WP_002935220.1.21016 WP_002935220.1.21156 WP_002935220.1.21217 WP_002935220.1.21374 WP_002935220.1.22433 WP_002935220.1.22462 WP_002935220.1.22805 WP_002935220.1.22848 WP_002935220.1.23074 WP_002935220.1.23225 WP_002935220.1.24550 WP_002935220.1.24875 WP_002935220.1.26183 WP_002935220.1.26324 WP_002935220.1.26507 WP_002935220.1.2789 WP_002935220.1.29299 WP_002935220.1.29545 WP_002935220.1.2991 WP_002935220.1.32292 WP_002935220.1.32342 WP_002935220.1.33297 WP_002935220.1.33471 WP_002935220.1.34462 WP_002935220.1.3475 WP_002935220.1.35306 WP_002935220.1.36437 WP_002935220.1.36774 WP_002935220.1.38285 WP_002935220.1.38936 WP_002935220.1.39228 WP_002935220.1.39983 WP_002935220.1.40265 WP_002935220.1.40278 WP_002935220.1.40872 WP_002935220.1.40962 WP_002935220.1.44200 WP_002935220.1.44378 WP_002935220.1.48370 WP_002935220.1.48583 WP_002935220.1.50188 WP_002935220.1.52490 WP_002935220.1.52559 WP_002935220.1.53412 WP_002935220.1.53872 WP_002935220.1.55319 WP_002935220.1.55707 WP_002935220.1.56150 WP_002935220.1.56848 WP_002935220.1.57286 WP_002935220.1.57294 WP_002935220.1.58281 WP_002935220.1.59929 WP_002935220.1.61024 WP_002935220.1.61034 WP_002935220.1.61397 WP_002935220.1.61885 WP_002935220.1.62112 WP_002935220.1.62743 WP_002935220.1.6278 WP_002935220.1.63815 WP_002935220.1.64120 WP_002935220.1.64384 WP_002935220.1.65090 WP_002935220.1.6605 WP_002935220.1.66347 WP_002935220.1.683 WP_002935220.1.69454 WP_002935220.1.70257 WP_002935220.1.70310 WP_002935220.1.70390 WP_002935220.1.71914 WP_002935220.1.73272 WP_002935220.1.74090 WP_002935220.1.74950 WP_002935220.1.75229 WP_002935220.1.7537 WP_002935220.1.7739 WP_002935220.1.77752 WP_002935220.1.78021 WP_002935220.1.7884 WP_002935220.1.78883 WP_002935220.1.78901 WP_002935220.1.79846 WP_002935220.1.79901 WP_002935220.1.80025 WP_002935220.1.81372 WP_002935220.1.82695 WP_002935220.1.82772 WP_002935220.1.82894 WP_002935220.1.83058 WP_002935220.1.8422 WP_002935220.1.84412 WP_002935220.1.86572 WP_002935220.1.86830 WP_002935220.1.86886 WP_002935220.1.87005 WP_002935220.1.87405 WP_002935220.1.88173 WP_002935220.1.88201 WP_002935220.1.88233 WP_002935220.1.88626 WP_002935220.1.88635 WP_002935220.1.88787 WP_002935220.1.90634 WP_002935220.1.92584 WP_002935220.1.93914 WP_002935220.1.95351 WP_002935220.1.95387 WP_002935220.1.95472 WP_002935220.1.96021 WP_002935220.1.96717 WP_002935220.1.97814 WP_002935220.1.98431 WP_002935220.1.98999 gi|330832861|ref|YP_004401686.1| 2005277317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]