SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330833449|ref|YP_004402274.1| from Streptococcus suis ST3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330833449|ref|YP_004402274.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.75e-35
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330833449|ref|YP_004402274.1|
Sequence length 104
Comment lactose-specific phosphotransferase system (PTS), IIA component 1 [Streptococcus suis ST3]
Sequence
MNTEELQMAAFGIILSSGNARSVIHEAFAAMREGDYDKAEELLEAANADMLEAHHSQTGL
LQEYASGTEVKVEIIMVHAQDHLMTTMTLREVALEMLALYRKVG
Download sequence
Identical sequences A0A0K2E809 A0A1V2SL55
gi|330833449|ref|YP_004402274.1| WP_002937728.1.100661 WP_002937728.1.100904 WP_002937728.1.101297 WP_002937728.1.101794 WP_002937728.1.101829 WP_002937728.1.101939 WP_002937728.1.102003 WP_002937728.1.102039 WP_002937728.1.10539 WP_002937728.1.10904 WP_002937728.1.11116 WP_002937728.1.11845 WP_002937728.1.13212 WP_002937728.1.1370 WP_002937728.1.14775 WP_002937728.1.15035 WP_002937728.1.15374 WP_002937728.1.17549 WP_002937728.1.17649 WP_002937728.1.17730 WP_002937728.1.19097 WP_002937728.1.1918 WP_002937728.1.19625 WP_002937728.1.20792 WP_002937728.1.20931 WP_002937728.1.20983 WP_002937728.1.21016 WP_002937728.1.21072 WP_002937728.1.21156 WP_002937728.1.21217 WP_002937728.1.22347 WP_002937728.1.22428 WP_002937728.1.22433 WP_002937728.1.22462 WP_002937728.1.22560 WP_002937728.1.23074 WP_002937728.1.23225 WP_002937728.1.24875 WP_002937728.1.25798 WP_002937728.1.26183 WP_002937728.1.26329 WP_002937728.1.27296 WP_002937728.1.2789 WP_002937728.1.2991 WP_002937728.1.30520 WP_002937728.1.31707 WP_002937728.1.31763 WP_002937728.1.32048 WP_002937728.1.32213 WP_002937728.1.32258 WP_002937728.1.32342 WP_002937728.1.33297 WP_002937728.1.33353 WP_002937728.1.33377 WP_002937728.1.34462 WP_002937728.1.3475 WP_002937728.1.35306 WP_002937728.1.35749 WP_002937728.1.36774 WP_002937728.1.39228 WP_002937728.1.39983 WP_002937728.1.40169 WP_002937728.1.40278 WP_002937728.1.40872 WP_002937728.1.40962 WP_002937728.1.42206 WP_002937728.1.42735 WP_002937728.1.43929 WP_002937728.1.44200 WP_002937728.1.44378 WP_002937728.1.44612 WP_002937728.1.47449 WP_002937728.1.48370 WP_002937728.1.50127 WP_002937728.1.50188 WP_002937728.1.50635 WP_002937728.1.51052 WP_002937728.1.52559 WP_002937728.1.53344 WP_002937728.1.53412 WP_002937728.1.5344 WP_002937728.1.53872 WP_002937728.1.53918 WP_002937728.1.54343 WP_002937728.1.54683 WP_002937728.1.55319 WP_002937728.1.55707 WP_002937728.1.56077 WP_002937728.1.56719 WP_002937728.1.56848 WP_002937728.1.57189 WP_002937728.1.57286 WP_002937728.1.57294 WP_002937728.1.58281 WP_002937728.1.5894 WP_002937728.1.60184 WP_002937728.1.60233 WP_002937728.1.61024 WP_002937728.1.61034 WP_002937728.1.61397 WP_002937728.1.62112 WP_002937728.1.62743 WP_002937728.1.63815 WP_002937728.1.65090 WP_002937728.1.6605 WP_002937728.1.66300 WP_002937728.1.66318 WP_002937728.1.66347 WP_002937728.1.66360 WP_002937728.1.683 WP_002937728.1.6967 WP_002937728.1.70257 WP_002937728.1.70310 WP_002937728.1.70390 WP_002937728.1.70403 WP_002937728.1.72030 WP_002937728.1.72185 WP_002937728.1.72924 WP_002937728.1.73272 WP_002937728.1.74368 WP_002937728.1.74950 WP_002937728.1.75229 WP_002937728.1.7537 WP_002937728.1.75524 WP_002937728.1.75643 WP_002937728.1.76811 WP_002937728.1.7739 WP_002937728.1.7763 WP_002937728.1.77752 WP_002937728.1.78021 WP_002937728.1.7884 WP_002937728.1.78883 WP_002937728.1.78901 WP_002937728.1.79610 WP_002937728.1.79846 WP_002937728.1.79901 WP_002937728.1.80025 WP_002937728.1.80235 WP_002937728.1.80787 WP_002937728.1.81372 WP_002937728.1.82418 WP_002937728.1.82695 WP_002937728.1.82772 WP_002937728.1.82894 WP_002937728.1.83058 WP_002937728.1.83279 WP_002937728.1.8414 WP_002937728.1.8422 WP_002937728.1.84489 WP_002937728.1.84535 WP_002937728.1.86572 WP_002937728.1.86830 WP_002937728.1.86886 WP_002937728.1.87005 WP_002937728.1.87405 WP_002937728.1.88173 WP_002937728.1.88233 WP_002937728.1.88626 WP_002937728.1.88787 WP_002937728.1.89981 WP_002937728.1.90634 WP_002937728.1.90917 WP_002937728.1.92584 WP_002937728.1.92964 WP_002937728.1.93914 WP_002937728.1.94291 WP_002937728.1.94587 WP_002937728.1.94661 WP_002937728.1.94780 WP_002937728.1.95387 WP_002937728.1.95472 WP_002937728.1.95788 WP_002937728.1.9594 WP_002937728.1.95984 WP_002937728.1.96021 WP_002937728.1.96717 WP_002937728.1.97515 WP_002937728.1.97814 WP_002937728.1.98431 WP_002937728.1.98999 WP_002937728.1.99664 gi|386584860|ref|YP_006081263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]