SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330832671|ref|YP_004401496.1| from Streptococcus suis ST3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330832671|ref|YP_004401496.1|
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.57e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330832671|ref|YP_004401496.1|
Sequence length 107
Comment phosphotransferase system PTS lactose/cellobiose-specific IIA subunit [Streptococcus suis ST3]
Sequence
MEMIVADQLIMGLIIYAGDAKSHAYQALSLVKAGEEERAEEELELADAALLEAHNMQTKF
LAQEAGGTKSDITALFVHSQDHLMTSITEINLIKEIIDLRKELKKVG
Download sequence
Identical sequences A0A142UNT2 G7SH72
gi|330832671|ref|YP_004401496.1| gi|499143369|ref|YP_007975433.1| gi|386586250|ref|YP_006082652.1| WP_002935429.1.100701 WP_002935429.1.101939 WP_002935429.1.10539 WP_002935429.1.1370 WP_002935429.1.14775 WP_002935429.1.15374 WP_002935429.1.17191 WP_002935429.1.17649 WP_002935429.1.18076 WP_002935429.1.19097 WP_002935429.1.1918 WP_002935429.1.19625 WP_002935429.1.1991 WP_002935429.1.20931 WP_002935429.1.20983 WP_002935429.1.21016 WP_002935429.1.21217 WP_002935429.1.22433 WP_002935429.1.22462 WP_002935429.1.22805 WP_002935429.1.23074 WP_002935429.1.24086 WP_002935429.1.24875 WP_002935429.1.26183 WP_002935429.1.26329 WP_002935429.1.2991 WP_002935429.1.32342 WP_002935429.1.33297 WP_002935429.1.34462 WP_002935429.1.3475 WP_002935429.1.35306 WP_002935429.1.36126 WP_002935429.1.36365 WP_002935429.1.38285 WP_002935429.1.39228 WP_002935429.1.39263 WP_002935429.1.40962 WP_002935429.1.41112 WP_002935429.1.43929 WP_002935429.1.44200 WP_002935429.1.44378 WP_002935429.1.50188 WP_002935429.1.52559 WP_002935429.1.53412 WP_002935429.1.53872 WP_002935429.1.5509 WP_002935429.1.55319 WP_002935429.1.55707 WP_002935429.1.55975 WP_002935429.1.56719 WP_002935429.1.56848 WP_002935429.1.57286 WP_002935429.1.57294 WP_002935429.1.58281 WP_002935429.1.61024 WP_002935429.1.62112 WP_002935429.1.62743 WP_002935429.1.63815 WP_002935429.1.65090 WP_002935429.1.6605 WP_002935429.1.6758 WP_002935429.1.70301 WP_002935429.1.70310 WP_002935429.1.71336 WP_002935429.1.718 WP_002935429.1.72030 WP_002935429.1.73272 WP_002935429.1.75229 WP_002935429.1.7537 WP_002935429.1.7739 WP_002935429.1.78021 WP_002935429.1.7884 WP_002935429.1.78901 WP_002935429.1.79846 WP_002935429.1.79901 WP_002935429.1.81332 WP_002935429.1.81372 WP_002935429.1.82695 WP_002935429.1.82772 WP_002935429.1.87005 WP_002935429.1.87405 WP_002935429.1.88173 WP_002935429.1.88233 WP_002935429.1.88626 WP_002935429.1.88787 WP_002935429.1.92584 WP_002935429.1.93914 WP_002935429.1.94291 WP_002935429.1.94780 WP_002935429.1.95387 WP_002935429.1.95472 WP_002935429.1.96717 WP_002935429.1.97814 WP_002935429.1.98889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]