SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325287567|ref|YP_004263357.1| from Cellulophaga lytica DSM 7489

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325287567|ref|YP_004263357.1|
Domain Number 1 Region: 216-408
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.32e-70
Family B3/B4 domain of PheRS, PheT 0.00000759
Further Details:      
 
Domain Number 2 Region: 42-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.18e-42
Family Myf domain 0.0022
Further Details:      
 
Domain Number 3 Region: 481-702
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.24e-31
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0018
Further Details:      
 
Domain Number 4 Region: 710-808
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.45e-29
Family Anticodon-binding domain of PheRS 0.001
Further Details:      
 
Domain Number 5 Region: 418-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.97e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325287567|ref|YP_004263357.1|
Sequence length 808
Comment Phenylalanyl-tRNA synthetase subunit beta [Cellulophaga lytica DSM 7489]
Sequence
MKISYNWLKQFLHIDWEADKTAELLTDLGLEVEGISEFESVKGGLKGIVVGHVLTCVKHP
NADKLKLTTVDIGADAPVQIVCGAPNVDKGQKVPVATIGTTLYTAEGEAWKIKKGKIRGE
ESHGMICAEDELGLGQSHEGIMVLADDLTPGTPCADIFEVELDTVFEIGLTPNRADAMSH
FGVARDLRAGLIQQEIKKELITPPVTNFNVENRSLKVTVDVDNNELAPRYCGVTISNLEI
KDSPDWLKNRLRSIGLTPKNNVVDATNYVLHELGQPLHAFDANKIKGHKIEVKTVAAGTK
FTTLDDVERELHEEDLMICDEEKPLCIAGILGGKDSGVTENTTAIFLESAYFNPVSVRKT
AKRHGLNTDASFRFERGIDIQNVEYALRRAASLIKEIAGGDITSDIVELYPKRVEDHEVF
LTYEKINKLIGQNIPGETIKSILTSLDIKVKNVSESGMGLAIPFYRVDVQRQVDVIEEIL
RVYGYNNINFTTKLNASIATTSRFEDYKLQNVIGNQLASQGFYEIMANSLTTIDYNKHSE
NLKDSNSVAMLNPLSSDLSVLRQSMLFSGLEAISHNINRKKLNLKFFEFGKTYHNYLDKR
IENKHLSLFLTGKQEDENWYATQNKSDFFYLKSCIETVFSKLGIRKTSSSPVENDVFQEG
LSLKANKLAVVEFGVIKPSITADFDIKQEVLFADFNWDNIIKLAKQNTIVFKEISKYPSV
KRDFALLLDTKVNFKDLYDIAFETEKKFLKEVNLFDVYTGDKLPKGKKSYAVSFTLSDDK
DTLKDKQIDKIMSKLRNNYEKKLGAELR
Download sequence
Identical sequences A0A1L7EFQ0 F0R9Z1 W7R1M5
WP_013622229.1.31452 WP_013622229.1.36574 WP_013622229.1.53776 WP_013622229.1.93229 gi|325287567|ref|YP_004263357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]