SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325287915|ref|YP_004263705.1| from Cellulophaga lytica DSM 7489

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325287915|ref|YP_004263705.1|
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.31e-52
Family PP-loop ATPase 0.0000299
Further Details:      
 
Domain Number 2 Region: 346-430
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000837
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325287915|ref|YP_004263705.1|
Sequence length 434
Comment tRNA(Ile)-lysidine synthase [Cellulophaga lytica DSM 7489]
Sequence
MLKEFKNHIKAHFPLLLQRPFLVACSGGVDSVVLAHLCAALQLDFSIAHCNFKLRDAASD
ADEEFVRQLALQLQKKIYVTNFNTVGYVAKNKVSIQMAARDLRYSWFAKLVKENNLETVL
TGHQADDNLETFLINLSRGTGVGGLLGIPSKTSALARPLLPFTRDEIEDFAKQNNIKWRE
DKSNKETKYLRNRIRHKIVPELKELHPTFLQNFNNTQAYLQETSVLAEDYIKLLKNKLFV
RKNGVIEVSVSKLLTYKPLKTYLYALFSSYGFTEWQDVANLLTAMSGKQVLSRTHRLVKN
RENLLLQELKEANSDVYLVNKDQETISYPIKLHFQNVSEIGITNDTTIYVDKSKLKFPLV
LRKREEGDVFYPFGQNGKKKLSKFYKDIKLSVVAKEEQWLLCSESNIVWVVGKRADNRFK
VNTDYANILKISIL
Download sequence
Identical sequences F0RCV2
gi|325287915|ref|YP_004263705.1| WP_013622577.1.53776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]