SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325286209|ref|YP_004261999.1| from Cellulophaga lytica DSM 7489

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325286209|ref|YP_004261999.1|
Domain Number 1 Region: 464-526
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000314
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325286209|ref|YP_004261999.1|
Sequence length 736
Comment sulfate transporter [Cellulophaga lytica DSM 7489]
Sequence
MTPKTNKTKTFVSALPKNIFSGFVVSLIALPLGLGLALASEAPPISGVIAAIVGGFIVSI
LGGSNVTITGPGNGMVIVLLSAIYTLGEGNLYQGYLFTLAAIIVSGFVMILLGFLKMGRL
ADFFPASAIEGMLAAIGIGILSKQFHIMLGNNNVSGNIVPLVLKFPFAIQNLWLTTNSSI
LAAAAIGVISLLIMVFYAKIRNKYFQLIPAPMWIIVLVVSLSYVLAGIGVNYPLTEDFLV
KIPADVTSNLAFPDFSKVYQPNFIIAVFSITLIASIESLLSIKAVDKLDTLNRRSNVNRD
LKALGVASIASGFLGGINVVTVIARSSVNVNNGATNRSANFFQAFFLTAFVLLFQEQLRK
IPLAALAAILVYTGYKLATPKTLQKIAKIGKEQIIIFLVTLLTTLFTNLITGISAGILIT
FIIHIILNKSFTLFFSNLLKPNILMYKEPDGGNFYISVKYFCSFLNFYKLKNKLDAIPED
NIVVLDFSMCNFVDHTVMEGLEGYVDTFSKKGGSIELIGLDKHGTDSAHPFAIRKILPFA
TKLTPVEGNLTKRQLLLKNTASNFKWDYIPEKNKNADFLTNFVFFKSREIRYFYNQLKAK
NNKVALMDVEFTEGAFIAREVIKTTVLHIKLDREVPVFTLDKEGLIKYLYSLAGFKELNI
ENHPDFNRRFYLSGEKPKQIQQLFTDELILFLESNPYYHIECNGSALLIIKKERLLSVQE
VKAMLYFGKQLHQILQ
Download sequence
Identical sequences F0RH88
WP_013620875.1.53776 WP_013620875.1.62073 gi|325286209|ref|YP_004261999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]