SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320105843|ref|YP_004181433.1| from Terriglobus saanensis SP1PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320105843|ref|YP_004181433.1|
Domain Number 1 Region: 55-116
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000314
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0083
Further Details:      
 
Weak hits

Sequence:  gi|320105843|ref|YP_004181433.1|
Domain Number - Region: 195-221
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320105843|ref|YP_004181433.1|
Sequence length 298
Comment protein PASTA domain-containing protein [Terriglobus saanensis SP1PR4]
Sequence
MALRVRWKRGPLKKPSWRMLQARRYFHIAMTVLAMLSVALVSALLTMRLAIHGSEVEVPN
LSGLTLEEAAAMTSKARLNLTLENKFYSTTVPSGRVLSQSPSAGSKVRPDWHVRVTESMG
GQKVSIPDTVGMTERDAAMAVRHALLDLGALAHIPAPGSSEMVLAQTPPPNAEGVDKPQV
SLLLSSGETLTTKAYVMPNLVGLTWHEAQTRMSAAGLRLVAITPYVAPEVIPSVTAAQVV
GQMAPVAVPVAPAPPVLTGGTVTSQLPLAGARVTGADAIKAYLNGAHNAPAVVAAPSL
Download sequence
Identical sequences E8V4N5
WP_013567172.1.63843 gi|320105843|ref|YP_004181433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]