SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320107297|ref|YP_004182887.1| from Terriglobus saanensis SP1PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320107297|ref|YP_004182887.1|
Domain Number 1 Region: 584-908
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.24e-124
Family Methionine synthase SAM-binding domain 0.0000000147
Further Details:      
 
Domain Number 2 Region: 33-307
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 6.28e-88
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0013
Further Details:      
 
Domain Number 3 Region: 425-575
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.1e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000135
Further Details:      
 
Domain Number 4 Region: 329-415
Classification Level Classification E-value
Superfamily Methionine synthase domain 2.48e-25
Family Methionine synthase domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320107297|ref|YP_004182887.1|
Sequence length 910
Comment methionine synthase [Terriglobus saanensis SP1PR4]
Sequence
MSASENDNVVKATETKPLRLSGSQPFTQQPGVFIMLGERTNVAGSPKFAKLIKEGKYEEA
VSVARQQVENGANVIDICMDEGMIDGVVAMTRYLQLLASEPEVAKVPFMVDSSKWEVIEA
GLKCLQGKGIVNSISLKEGEDKFRQNAAAVLKYGAAVVVMAFDEQGQAATFEEKIRICER
AYRILVDEVDFPPEDIIFDPNILTVATGMEEHNNYAVDFINATRWIKANLPHAKVSGGVS
NISFSFRGNNKVREAMHSAFLYHAIGAGMDMGIVNAGMLELYEEIDPELKVLVEDVLLNR
RPDATERLVEFGESLKNVGVAVSEKKAEEWRNGTVEERLSHALVRGIDAYIEIDAEEARV
KLGRPLLVIEGPLMAGMSVVGDLFGAGKMFLPQVVKSARVMKKAVAHLTPFMEAEKAALL
ASGQEVKAQGKIVLATVKGDVHDIGKNIVGVVLACNNFEVIDMGVMVSSEKILERAKTEK
ADIIGLSGLITPSLDEMVHVAKEMERQGFKLPLLVGGATTSRAHTAVKIAPHYSQPVVHV
LDASRAVPVTTSLLSEDGKADFVIKHRADYEALRKAHSAPRHQITPLATARARRTPIEWR
IEDLAVPAFTGVRVLDKFPLATLRDFIDWSPFFHTWGLKGIYPRILDDERQGAQARQVFT
EGNALLDTIIKKNLITARGVYGFFPANAVGDDVELYTDETRTEVLQTFHFLRQQANREGT
EPCRSLADFIAPKETGLPDYIGGFAVTSGMGLKEVCDAFRADNDDYNAIMAEAIADRLAE
AFAECLHKRVRDEWGYGLDENLSPEECIHEKYRGIRPAPGYPACPDHTEKSALWDLLNAE
ANTGIFLTESFAMWPGSSVSGIYFGHPKSRYFSLGKIDRDQVADYHERKGMTVAEVEKWL
GQNLNYDADE
Download sequence
Identical sequences E8V7W9
gi|320107297|ref|YP_004182887.1| WP_013568626.1.63843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]