SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320107508|ref|YP_004183098.1| from Terriglobus saanensis SP1PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320107508|ref|YP_004183098.1|
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000123
Family Terminase gpNU1 subunit domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320107508|ref|YP_004183098.1|
Sequence length 70
Comment excisionase family DNA-binding domain-containing protein [Terriglobus saanensis SP1PR4]
Sequence
MSPLGETPAKFLTAEEAAVHLGCLNSRTVSRWAREGYLPAYALGEGKRRLWRFLLTDLDA
WMRARRTVTA
Download sequence
Identical sequences E8UXT8
WP_013568837.1.63843 gi|320107508|ref|YP_004183098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]