SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320108123|ref|YP_004183713.1| from Terriglobus saanensis SP1PR4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|320108123|ref|YP_004183713.1|
Domain Number - Region: 32-84
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000348
Family Terminase gpNU1 subunit domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320108123|ref|YP_004183713.1|
Sequence length 95
Comment hypothetical protein AciPR4_2959 [Terriglobus saanensis SP1PR4]
Sequence
MENRDLHLANSVSDSTAPPRKPPTRWIPVEPLLTAEDVARRLNVSTDWVWDHSSRKKPLL
PVIRMGDGALRYRASGIELFITEHEQIGKLRRRTG
Download sequence
Identical sequences E8V532
WP_013569451.1.63843 gi|320108123|ref|YP_004183713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]