SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320108517|ref|YP_004184107.1| from Terriglobus saanensis SP1PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320108517|ref|YP_004184107.1|
Domain Number 1 Region: 37-303
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.32e-66
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320108517|ref|YP_004184107.1|
Sequence length 307
Comment proline dehydrogenase [Terriglobus saanensis SP1PR4]
Sequence
MNLFRDAFISLSESKSLRHFAENSTLARKVSGRFVAGVSLSEALAACQEENRHGRSVTLD
ALGENVQSEAHAQATAAIYHLMLDRIAEMGLDANVSLKLTQMGMDLGVDVAESIVKSLSE
HACALNNFVRVDMEGSSYTEDTIGIVTRLHGAPAIGDSVGVVVQSYLFRTEEDIDHLIAN
GIRVRLCKGAYKETENIAFAAKGDVDANYVKLMKRLLTSGIFHGLATHDESIIHQAQAFV
KEQGIDPSGFEFQMLYGIRRDLQDSLVKQGYRVRVYVPFGGEWYPYFMRRLAERPANALF
IARNLFR
Download sequence
Identical sequences E8V8S6
WP_013569844.1.63843 gi|320108517|ref|YP_004184107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]