SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320105524|ref|YP_004181114.1| from Terriglobus saanensis SP1PR4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320105524|ref|YP_004181114.1|
Domain Number 1 Region: 100-202
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000623
Family DNA-binding N-terminal domain of transcription activators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320105524|ref|YP_004181114.1|
Sequence length 242
Comment regulatory protein MerR [Terriglobus saanensis SP1PR4]
Sequence
MWIPGSLGREPNGGGQSCRSSFPAFTCPLSEAPLIAGPFFRRELEKKLDGDGNRENYIQP
ILRRLILARIGPSLAPSFRMTPSSPIRQIGKSEIPDKLYFRIGEVARLCEVPPYVLRFWE
SEFPQLKPNKGGTGQRLYRRKDAEMAMRIKRLLYDEGYTIPGARQVFKSEVKQKEPELFR
MEPSQAVPKTDLSSLRKSLQEIADLLSRPSPGTVGQSRRARIIPSTRQTKVMDRKPELPP
LF
Download sequence
Identical sequences E8V0Q7
gi|320105524|ref|YP_004181114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]