SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319775870|ref|YP_004138358.1| from Haemophilus influenzae F3047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319775870|ref|YP_004138358.1|
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily ITPase-like 1.31e-69
Family ITPase (Ham1) 0.000000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319775870|ref|YP_004138358.1|
Sequence length 195
Comment xanthosine triphosphate pyrophosphatase [Haemophilus influenzae F3047]
Sequence
MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGLTFVENALLKARYASE
KSGLPAIADDSGLVVSALNGAPGLYSARYAGEEGNDAKNREKLLAELAHVAQDQRQAKFV
SCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFSPEQGCTFAELETVEKKK
ISHRAKALSVLKSKL
Download sequence
Identical sequences A0A0Y0EPG4 A4NVH2 F2C2T4
WP_005668864.1.13610 WP_005668864.1.17253 WP_005668864.1.25656 WP_005668864.1.34925 WP_005668864.1.37452 WP_005668864.1.42267 WP_005668864.1.54653 WP_005668864.1.57312 WP_005668864.1.6054 WP_005668864.1.63539 WP_005668864.1.75193 WP_005668864.1.76348 WP_005668864.1.81823 WP_005668864.1.82376 WP_005668864.1.85362 WP_005668864.1.86649 WP_005668864.1.88810 WP_005668864.1.93392 WP_005668864.1.93908 WP_005668864.1.9761 WP_005668864.1.97721 gi|319775870|ref|YP_004138358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]