SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378722087|ref|YP_005286973.1| from Rickettsia rickettsii str. Arizona

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378722087|ref|YP_005286973.1|
Domain Number 1 Region: 57-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.57e-22
Family Ribosomal protein L9 C-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000153
Family Ribosomal protein L9 N-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378722087|ref|YP_005286973.1|
Sequence length 171
Comment 50S ribosomal protein L9 [Rickettsia rickettsii str. Arizona]
Sequence
MEIILIKPVRKLGKIGDILKVADGFGRNYLLPQKLAIRATEPNKELIVKQKHEFEAKDKQ
IREEVEKINALIKDQQLVFIRQTSNDGKLFGSVTNKEIANKLSENISYNISHSNVILDKQ
IKSTGIYTVEIRLHAELNAIVTVIVARSESEAQDYLREQKTETSEDLAESA
Download sequence
Identical sequences A8GQJ6 B0BVY2 H6PVL7
gi|379018567|ref|YP_005294801.1| WP_012150293.1.16657 WP_012150293.1.17801 WP_012150293.1.31136 WP_012150293.1.3339 WP_012150293.1.38731 WP_012150293.1.4490 WP_012150293.1.74071 WP_012150293.1.76853 WP_012150293.1.77680 WP_012150293.1.78650 WP_012150293.1.81845 WP_012150293.1.83836 WP_012150293.1.89241 gi|378720736|ref|YP_005285623.1| gi|157827937|ref|YP_001494179.1| gi|165932625|ref|YP_001649414.1| gi|379017236|ref|YP_005293470.1| gi|379711805|ref|YP_005300144.1| gi|379017002|ref|YP_005293237.1| gi|378723446|ref|YP_005288330.1| gi|378722087|ref|YP_005286973.1| 392021.A1G_00415 452659.RrIowa_0086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]