SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379015948|ref|YP_005292183.1| from Rickettsia rickettsii str. Brazil

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379015948|ref|YP_005292183.1|
Domain Number 1 Region: 41-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.38e-26
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379015948|ref|YP_005292183.1|
Sequence length 372
Comment ABC transporter substrate-binding protein [Rickettsia rickettsii str. Brazil]
Sequence
MASIKHKLRIVLSFFCLIYLTSCQTPKEEPISFPKKEQTEIEIAILMPNQGPDSIVGKQY
KDLIKMGLNDGIKSYIHVTSYDGSDEKNVLAAMDKIVARKTKIILGPLYSNFTSLIAEKA
KANDIIIITMSNNPALAEDKLFVFGHAPLKQLIRIINYYASNNHKDFMALLPKGKHSQTI
SQVMQNILIQNNASLSSTEFYEDNPESIAKAARNISDNTDIINERSDTTKPVIYLSDDPK
NLNLLADSIRKYNLDKKAILIGDHRIDIDYPENIDISFTGSLNLLNSNVPDRAKDLGINH
IGFMHLLSYDLGRMTANYIGNEFASERFLNRMNSRQPYIGLSGNIYFIDGVAQRRYDIIR
KKNGIYSTVSEN
Download sequence
Identical sequences A0A0H3AXM0 B0BV40 H6PV61
gi|378723151|ref|YP_005288037.1| gi|379015948|ref|YP_005292183.1| gi|157828994|ref|YP_001495236.1| gi|379712876|ref|YP_005301215.1| gi|378724505|ref|YP_005289389.1| 392021.A1G_06375 452659.RrIowa_1366 gi|165933717|ref|YP_001650506.1| gi|379018291|ref|YP_005294526.1| gi|378721806|ref|YP_005286693.1| WP_012151278.1.16657 WP_012151278.1.17801 WP_012151278.1.31136 WP_012151278.1.3339 WP_012151278.1.38731 WP_012151278.1.4490 WP_012151278.1.74071 WP_012151278.1.77680 WP_012151278.1.78650 WP_012151278.1.81845 WP_012151278.1.83836 WP_012151278.1.89241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]