SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334146131|ref|YP_004509058.1| from Porphyromonas gingivalis TDC60

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334146131|ref|YP_004509058.1|
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.31e-57
Family PP-loop ATPase 0.00015
Further Details:      
 
Domain Number 2 Region: 370-439
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000262
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334146131|ref|YP_004509058.1|
Sequence length 454
Comment putative cell-cycle protein [Porphyromonas gingivalis TDC60]
Sequence
MKISLTNRVRTTIRERKLFREGDRLVLVALSGGADSVALLCVLRELGYETVAAHCNFHLR
GVESDEDAAFVERLCRDLDVPLHRIDFDTVRYARERSISIEMAARELRYEWFGQLRKELA
IEYVAVAHHADDNAETMVLNLCRGTGISGLCGMPYKRNDGIVRPLLDATRDEIEAYLLDQ
KITYRTDSSNEDTRFRRNLVRHRIMPLLKELNPSLQEALLRTRENLEGVAAFYSKATEDF
HNTLRATSSISIREVKETPAPFTLLYDLLHPYGFNRDQIREVATSLDNPPGASFFSSSHR
LLRERDRLTVLPLSPKMEVPELFGLKIGDSFLDLPDGKQLSWQRGTPADLDLEGLRLPNT
KLLLPLAFVESLQEELGVRRPQRGDHIHPYGMKGCKTVSRFFIDRHVPRSRREEAWLLCQ
GTEVVWIMGYAADRRFAIDELSDTEEYLLFSFGL
Download sequence
Identical sequences A0A2I7MTW0 Q7MTC4
242619.PG2046 WP_005874428.1.19526 WP_005874428.1.27553 WP_005874428.1.39476 WP_005874428.1.94381 WP_005874428.1.99224 gi|34541632|ref|NP_906111.1| gi|334146131|ref|YP_004509058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]